Protein Info for Xcc-8004.1756.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Carbon starvation protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 690 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 54 (21 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 159 to 182 (24 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details amino acids 220 to 239 (20 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details amino acids 324 to 346 (23 residues), see Phobius details amino acids 366 to 389 (24 residues), see Phobius details amino acids 465 to 484 (20 residues), see Phobius details amino acids 510 to 529 (20 residues), see Phobius details amino acids 542 to 566 (25 residues), see Phobius details amino acids 573 to 594 (22 residues), see Phobius details amino acids 641 to 664 (24 residues), see Phobius details PF02554: CstA" amino acids 31 to 408 (378 residues), 581.3 bits, see alignment E=8.1e-179 PF13722: CstA_5TM" amino acids 463 to 591 (129 residues), 143.6 bits, see alignment E=3.7e-46

Best Hits

Swiss-Prot: 67% identical to CSTA_ECOLI: Peptide transporter CstA (cstA) from Escherichia coli (strain K12)

KEGG orthology group: K06200, carbon starvation protein (inferred from 100% identity to xcc:XCC2718)

MetaCyc: 67% identical to pyruvate transporter CstA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-335

Predicted SEED Role

"Carbon starvation protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X5U9 at UniProt or InterPro

Protein Sequence (690 amino acids)

>Xcc-8004.1756.1 Carbon starvation protein A (Xanthomonas campestris pv. campestris strain 8004)
MKGISKLAWGALALLAAFCLGTVALRRGEHINALWIVVAAVSIYLIAYRFYGLFIADKVM
QLDPTRATPAVTNNDGLDYVPTNKHVLFGHHFAAIAGAGPLVGPVLAAQMGYLPGLLWLV
VGVVLAGAVQDFMVLFLSTRRNGRSLGDLVREEMGQVPGTIALFGAFLIMIIILAVLAMV
VVKALAESPWGMFTVIATMPIAIMMGVYMRYIRPGKIGEISVVGLILLLGAIWLGGQVAA
DPTWGPAFTFTAKQITWMLIGYGFIASVLPVWLLLAPRDYLSTFLKIGTILGLAIGILIV
MPDLKMPALTQFAASGDGPVWKGGIFPFLFITIACGAVSGFHALIASGTTPKLLANEAHM
RYIGYGGMLMESFVAIMALVAASIIEPGIYFAMNSPASLVGSDTVAVAAKVSEWGFAITP
EVLEATARDIGEHSILARAGGAPTLAVGIAQILHHVLPGENTMAFWYHFAILFEALFILT
AVDAGTRAGRFMLQDLLGNFIPALKKTESWTANIIATAGCVALWGYLLYTGVIDPFGGIQ
TLWPLFGISNQMLAGIALMLGTVVLFKMKRDRYAWVTIVPALWLLLCTTYAGLIKIFDSN
PAQGFLAQAHKFQAAIASNTITAPAKTVPQMQQIVTNAYVNTGLTVLFLFVVGSILIYAV
KTIVVARRSPQRSDRETPYVALQPHQMADL