Protein Info for Xcc-8004.1663.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Lipopolysaccharide ABC transporter, ATP-binding protein LptB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 TIGR04406: LPS export ABC transporter ATP-binding protein" amino acids 2 to 239 (238 residues), 376.2 bits, see alignment E=2.9e-117 PF00005: ABC_tran" amino acids 18 to 164 (147 residues), 120.9 bits, see alignment E=6.1e-39 PF12399: BCA_ABC_TP_C" amino acids 213 to 236 (24 residues), 29.2 bits, see alignment (E = 5.5e-11)

Best Hits

Swiss-Prot: 59% identical to LPTB_ECOLI: Lipopolysaccharide export system ATP-binding protein LptB (lptB) from Escherichia coli (strain K12)

KEGG orthology group: K06861, lipopolysaccharide export system ATP-binding protein [EC: 3.6.3.-] (inferred from 100% identity to xca:xccb100_1359)

MetaCyc: 59% identical to lipopolysaccharide transport system ATP binding protein LptB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-237 [EC: 7.5.2.5]

Predicted SEED Role

"Lipopolysaccharide ABC transporter, ATP-binding protein LptB" in subsystem KDO2-Lipid A biosynthesis

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.5.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X597 at UniProt or InterPro

Protein Sequence (239 amino acids)

>Xcc-8004.1663.1 Lipopolysaccharide ABC transporter, ATP-binding protein LptB (Xanthomonas campestris pv. campestris strain 8004)
MLVATGLRKKYKQREVVKEFGLTLEAGEVVGLLGPNGAGKTTCFYMIVGLVEADAGRIEL
DGRDLTAEPMYARAKLGVGYLPQEPSVFRKLSVADNIRLVLELRDDLDGPGQEKELASLL
EELQITHVADQLGASLSGGERRRCEIARALAAKPRMMLLDEPFAGVDPISVGEIQRIVIH
LKERGIGVLITDHNVRETLGICDRAYILAEGGVLAQGAPDALLNNPDVRRVYLGDTFRL