Protein Info for Xcc-8004.1654.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Mg/Co/Ni transporter MgtE / CBS domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 289 to 309 (21 residues), see Phobius details amino acids 318 to 342 (25 residues), see Phobius details amino acids 363 to 385 (23 residues), see Phobius details amino acids 391 to 414 (24 residues), see Phobius details amino acids 424 to 452 (29 residues), see Phobius details TIGR00400: magnesium transporter" amino acids 21 to 451 (431 residues), 291.9 bits, see alignment E=4.2e-91 PF03448: MgtE_N" amino acids 37 to 137 (101 residues), 96.5 bits, see alignment E=1.9e-31 PF00571: CBS" amino acids 221 to 258 (38 residues), 23.4 bits, see alignment 9.1e-09 PF01769: MgtE" amino acids 323 to 446 (124 residues), 117.4 bits, see alignment E=7.7e-38

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 100% identity to xcc:XCC2810)

Predicted SEED Role

"Mg/Co/Ni transporter MgtE / CBS domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X5P2 at UniProt or InterPro

Protein Sequence (453 amino acids)

>Xcc-8004.1654.1 Mg/Co/Ni transporter MgtE / CBS domain (Xanthomonas campestris pv. campestris strain 8004)
MAEAVRHDKTARQLRLLSDALDSGRLGPVRRLVNTLAPAEIGNLLESLPPGKREVVWGLV
DPEDDGEVLLHVGDEVRESLLADMDPDEIVAAVEDLDIDDLANLVEDLPDTVIDEVLKSM
DRENRERLEQVLSYPEDTAGRLMNPDVVTVRADVNVDVVLRYLRLRGELPDHTDHLYVVS
RRHQYLGRVPLAALVTHEDSTPVNRLIDDEQPAIDVGDGSDEVARRFSDHDWISAPVVDD
NNILLGRITIDDVVDIIREQAEHQALSAAGLDEDEDMFSPARRAFRRRLIWLGINLCTAF
LASSVVSQFEGTIEKLVALAALMPIVAGMGGNAGTQVLALMVRGLALGQIGSSNVMTLLK
KELTVALINGMVLGIGLGVIVLVWFRQPMLSLVIGTALTLNMLTAAFGGVLVPVTLKRLG
FDPALAGGVILTTLTDVMGFLSFLGLATLILLR