Protein Info for Xcc-8004.1448.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF16331: TolA_bind_tri" amino acids 26 to 98 (73 residues), 67.4 bits, see alignment E=3.8e-22 TIGR02795: tol-pal system protein YbgF" amino acids 144 to 262 (119 residues), 136.6 bits, see alignment E=3.1e-44 PF13525: YfiO" amino acids 144 to 266 (123 residues), 42.5 bits, see alignment E=2.6e-14 PF13432: TPR_16" amino acids 154 to 214 (61 residues), 32.5 bits, see alignment E=3.7e-11 PF13174: TPR_6" amino acids 184 to 214 (31 residues), 24.8 bits, see alignment 9.5e-09 amino acids 222 to 252 (31 residues), 27.7 bits, see alignment 1.1e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to xcb:XC_1143)

Predicted SEED Role

"TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X6P2 at UniProt or InterPro

Protein Sequence (272 amino acids)

>Xcc-8004.1448.1 TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain (Xanthomonas campestris pv. campestris strain 8004)
MRFRVTSLFVAAALVVAAPAYAQRASLADRVAVLEQQQANSQANNDLLNQLQQARSDLQA
LRATVEQLQHDNEQLKQQSKDQYLDLDGRLNRLEGAGGAVPPLPSATGSVTPAPAPAARP
AAAATSEKPPTVHGDPGTLAISNEERTAYNVAFDALKNGKYDDASQLFLSFLELYPNGVY
TPNALYWLGESYYATRNFQLAEAQFRDLVSRYPTHDKAAGGLLKLGLSQYGEGKNTEAQQ
TLQQVATQYPGSDAARVAQERLQSIRLGQQLR