Protein Info for Xcc-8004.1372.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Trehalose-6-phosphate phosphatase (EC 3.1.3.12)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00685: trehalose-phosphatase
  • amino acids 19 to 247 (229 residues), 128.9 bits, E=3e-41
• TIGR01484: HAD hydrolase, family IIB
  • amino acids 20 to 214 (195 residues), 73.5 bits, E=2.6e-24
• PF02358: Trehalose_PPase
  • amino acids 21 to 222 (202 residues), 98.1 bits, E=4.6e-32

Best Hits

KEGG orthology group: K01087, trehalose-phosphatase [EC: 3.1.3.12] (inferred from 100% identity to xcb:XC_1078)

Predicted SEED Role

"Trehalose-6-phosphate phosphatase (EC 3.1.3.12)" in subsystem Trehalose Biosynthesis (EC 3.1.3.12)

MetaCyc Pathways

• trehalose biosynthesis I (2/2 steps found)
• trehalose biosynthesis II (1/2 steps found)
• trehalose biosynthesis III (1/2 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (4/8 steps found)
• mycolate biosynthesis (21/205 steps found)
• superpathway of mycolate biosynthesis (22/239 steps found)

KEGG Metabolic Maps

• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.12

Sequence Analysis Tools

See A0A0H2X588 at UniProt or InterPro

Protein Sequence (252 amino acids)

>Xcc-8004.1372.1 Trehalose-6-phosphate phosphatase (EC 3.1.3.12) (Xanthomonas campestris pv. campestris strain 8004)
MADLHSPLPSPPLLDDACALFLDVDGTLIDFAHTPEAVQLLPEVRDAIARLSERLGGAVA
LVSGRPLSQLDALFAPLLLPAAGLHGHELRSDAAARAAMPQDTSEWLHGLHKRAAALTHQ
HPGVLVEDKGVSVALHWRAQPLAGPDVLAFAQQEIAALSGYRLQPGDHVVEFVPEGSNKG
LAVEQLMQQPAFAGRTPVFVGDDLTDEFGFQAANRLGGWSVLVGDRAQTDARFRVSGTAA
VHAWLQRSAHTA