Protein Info for Xcc-8004.1181.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Proton/glutamate symport protein @ Sodium/glutamate symport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 18 to 37 (20 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 166 to 191 (26 residues), see Phobius details amino acids 212 to 237 (26 residues), see Phobius details amino acids 243 to 265 (23 residues), see Phobius details amino acids 353 to 371 (19 residues), see Phobius details amino acids 377 to 398 (22 residues), see Phobius details PF00375: SDF" amino acids 14 to 423 (410 residues), 376.5 bits, see alignment E=7.9e-117

Best Hits

KEGG orthology group: K03309, dicarboxylate/amino acid:cation (Na+ or H+) symporter, DAACS family (inferred from 100% identity to xca:xccb100_0965)

Predicted SEED Role

"Proton/glutamate symport protein @ Sodium/glutamate symport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X4K3 at UniProt or InterPro

Protein Sequence (426 amino acids)

>Xcc-8004.1181.1 Proton/glutamate symport protein @ Sodium/glutamate symport protein (Xanthomonas campestris pv. campestris strain 8004)
MTASPAARRPGLPLHWKMGIGFAIGLVLGLAVYYLAGSDAEWVRLVTKYVTTPFSQIFLN
LIFMLIVPLLFSALVVGIAEMGDIRALGRVGWRTLGYTVVLSGIAVLLGLVLVNVLKPGA
GVDPQLANQLIQENADRTREIISSSGNQPQGMDMLLSIVPNNVIAAASSNGAILSLMFFA
VMFGVGMVLTADEKVATLKRGIEGIFEISMTLIGLVIRLAPYAVACFMFNLAALFGFDLL
IRLGAYVGVVVLALGLHMVVSYGLAVKFAGRSPIGFFRQTQEATLMAFSTASSNATLPTA
LRVADEMGLPPRVSRFVLTVGATANQNGTALFEGVTVIFLAQFFNVDLRIGQQFMVMIVC
ILGGIGTAGVPSGSLPVVALICAMVGVNPVGIGMILGVNHFLDMCRTALNVTGDLALTTL
VAKGEK