Protein Info for Xcc-8004.1107.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase (EC 6.3.2.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 TIGR01081: UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase" amino acids 21 to 469 (449 residues), 622.4 bits, see alignment E=2.5e-191 PF01225: Mur_ligase" amino acids 22 to 116 (95 residues), 63.4 bits, see alignment E=3.2e-21 PF08245: Mur_ligase_M" amino acids 127 to 312 (186 residues), 82.6 bits, see alignment E=5.7e-27 PF02875: Mur_ligase_C" amino acids 332 to 405 (74 residues), 42.7 bits, see alignment E=8.5e-15

Best Hits

Swiss-Prot: 50% identical to MPL_HAEIN: UDP-N-acetylmuramate--L-alanyl-gamma-D-glutamyl-meso-2,6-diaminoheptandioate ligase (mpl) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02558, UDP-N-acetylmuramate: L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase [EC: 6.3.2.-] (inferred from 100% identity to xcb:XC_0874)

MetaCyc: 59% identical to UDP-N-acetylmuramate--L-alanyl-gamma-D-glutamyl-meso-2,6-diaminoheptandioate ligase (Pseudomonas aeruginosa PAO1)
RXN0-2361 [EC: 6.3.2.45]

Predicted SEED Role

"UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase (EC 6.3.2.-)" (EC 6.3.2.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.-

Use Curated BLAST to search for 6.3.2.- or 6.3.2.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X612 at UniProt or InterPro

Protein Sequence (470 amino acids)

>Xcc-8004.1107.1 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase (EC 6.3.2.-) (Xanthomonas campestris pv. campestris strain 8004)
VRCGFEYPATPAIGDNEAMSKLHILGIAGTFMGGVAALARELGWQVEGSDQAIYPPMSTQ
LETLGIRLAQGYLPANISADAQDVVIGNALSRGNAAVEAVLDAGRRYSSGAQWLAEQVLP
GRDTLAVAGTHGKTTTTTILSYLLEAAGRAPGFLIGGVAEDFGVSARLGQGREFVVEADE
YDTAFFDKRSKFVHYRPLVAILNNLEYDHADIFPDVAAIQRQFHHLVRTVPARGRLIVNG
EDARLAEVLAMGCWTPVERFGFDPALDWSAQLLADDGSRFAVLHRGEEIGQVQWPLLGRH
NVLNGLAALAAVQAVGVDPVTVMPALARFQSVKRRLEVLGQAQGITVYDDFAHHPTAIAT
TLQGLRAKVGTARVLVAMEPRSNSMRLGAHAQALAPSLHDADAVVFLHRPELAWDAAPII
AQVRGQAHVAQDVDTLLRMLGEIAQPGDHVVFMSNGGFDGAPRRFLAGLA