Protein Info for Xcc-8004.1058.1 in Xanthomonas campestris pv. campestris strain 8004

Updated annotation (from data): acetolactate synthase, regulatory subunit (EC 2.2.1.6)
Rationale: Cofit with the adjacently encoded catalytic subunit (Xcc-8004.1059.1). Most regulatory subunits have two ACT-like domains, but this has just one ACT domain, as with E. coli ilvM (PMID:19653643)
Original annotation: Acetolactate synthase small subunit (EC 2.2.1.6), Xanthomonadales type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13710: ACT_5
  • amino acids 12 to 73 (62 residues), 73.5 bits, E=4.7e-25

Best Hits

KEGG orthology group: K11258, acetolactate synthase II small subunit [EC: 2.2.1.6] (inferred from 100% identity to xca:xccb100_0872)

Predicted SEED Role

"Acetolactate synthase small subunit (EC 2.2.1.6), Xanthomonadales type" in subsystem Branched-Chain Amino Acid Biosynthesis (EC 2.2.1.6)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-valine biosynthesis (4/4 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• pyruvate fermentation to (R)-acetoin I (2/3 steps found)
• pyruvate fermentation to (S)-acetoin (2/3 steps found)
• L-isoleucine biosynthesis IV (4/6 steps found)
• pyruvate fermentation to (R)-acetoin II (1/2 steps found)
• superpathway of L-threonine metabolism (12/18 steps found)
• L-isoleucine biosynthesis III (4/7 steps found)
• superpathway of (R,R)-butanediol biosynthesis (2/5 steps found)
• L-isoleucine biosynthesis II (4/8 steps found)
• superpathway of 2,3-butanediol biosynthesis (2/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Butanoate metabolism
• C5-Branched dibasic acid metabolism
• Pantothenate and CoA biosynthesis
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Sequence Analysis Tools

See A0A0H2X4P1 at UniProt or InterPro

Protein Sequence (85 amino acids)

>Xcc-8004.1058.1 acetolactate synthase, regulatory subunit (EC 2.2.1.6) (Xanthomonas campestris pv. campestris strain 8004)
MRYRLDLVLKPAEGALVRVIGMTERRGFRPCAIQGAAAPDDAGRWHLQLDVDSTRPPETL
RLQLEKVYDCESVAITALDSVEAAA