Protein Info for TX73_024500 in Rhodopseudomonas palustris CGA009

Annotation: molybdate ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details amino acids 199 to 219 (21 residues), see Phobius details TIGR02141: molybdate ABC transporter, permease protein" amino acids 14 to 222 (209 residues), 238.6 bits, see alignment E=2.7e-75 PF00528: BPD_transp_1" amino acids 30 to 215 (186 residues), 60.3 bits, see alignment E=1.1e-20

Best Hits

Swiss-Prot: 64% identical to MODB_AZOVI: Molybdenum transport system permease protein ModB (modB) from Azotobacter vinelandii

KEGG orthology group: K02018, molybdate transport system permease protein (inferred from 100% identity to rpa:RPA4716)

Predicted SEED Role

"Molybdenum transport system permease protein ModB (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>TX73_024500 molybdate ABC transporter permease subunit (Rhodopseudomonas palustris CGA009)
MTNLPPDIWQPVRLTIELAAITTLILLIVGTPIAWWLARSKAWWKEGIAAVVALPLVLPP
TVLGFYLLVLMGPDGPGGALASLWGGRTVAFTFGGLVFGSVIYSMPFVVQPIRNAFDAIG
DRPLEVAATLRASPLKAFWTVAMPLARPGFLAGAVLGFAHTVGEFGIVLMIGGNIPGSTK
VLSVAIYDYVETSQWREANILAGGMAAFAFVVILTMMMLEKRTARIRT