Protein Info for TX73_024495 in Rhodopseudomonas palustris CGA009

Annotation: molybdenum ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 TIGR02142: molybdate ABC transporter, ATP-binding protein" amino acids 9 to 365 (357 residues), 412.8 bits, see alignment E=6.5e-128 PF00005: ABC_tran" amino acids 24 to 167 (144 residues), 100.7 bits, see alignment E=1.6e-32 PF03459: TOBE" amino acids 300 to 365 (66 residues), 30.3 bits, see alignment E=6.1e-11

Best Hits

Swiss-Prot: 100% identical to MODC_RHOPA: Molybdenum import ATP-binding protein ModC (modC) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K02017, molybdate transport system ATP-binding protein [EC: 3.6.3.29] (inferred from 100% identity to rpa:RPA4715)

Predicted SEED Role

"Molybdenum transport ATP-binding protein ModC (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>TX73_024495 molybdenum ABC transporter ATP-binding protein (Rhodopseudomonas palustris CGA009)
MRALTPPTIRAAFRGQLGGFALDAAFTVPATGITGLFGPSGCGKSSVLRCLAGLQHLPGS
SCEVGGEVWQDDTTFLKPHHRPIGYVFQEASLFQHLSVKANLLYGAPRESGKAHADAVEF
DEVIELLGLAKLLARSPRNLSGGERQRVAIGRALLSQPKLLLMDEPLSALDRLTKDEILP
FLERLHARLSLPVIYVSHDITEIERLADHLVLMQSGKVLAVGPLTELQSDPKLPLAIARD
AAVNFDAEVESYDADYGLVRLQIDGGRLLVPSAPVATGEFRRVRIAASDVSLARELPQAS
SILNAIAARIVITSPVGANEMLVVLALGREGHGGRLLARLSRRSWDLLQLAEGVDVYAQI
KGVALAPGRDGHV