Protein Info for TX73_024010 in Rhodopseudomonas palustris CGA009

Annotation: putative nitrogen fixation protein NifT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 66 TIGR02934: probable nitrogen fixation protein FixT" amino acids 1 to 66 (66 residues), 105.4 bits, see alignment E=5e-35 PF06988: NifT" amino acids 1 to 63 (63 residues), 100.6 bits, see alignment E=1.6e-33

Best Hits

Swiss-Prot: 61% identical to FIXU_SINFN: Protein FixU homolog (fixU) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02593, nitrogen fixation protein NifT (inferred from 100% identity to rpa:RPA4623)

Predicted SEED Role

"NifT protein" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (66 amino acids)

>TX73_024010 putative nitrogen fixation protein NifT (Rhodopseudomonas palustris CGA009)
MKVMIRKTATGHSAYVAKKDLEELIVEMENPALWGGKVTLANGWQLELPAMAADTPLPIT
VEARKL