Protein Info for TX73_022575 in Rhodopseudomonas palustris CGA009

Annotation: aminoacyl-tRNA hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 TIGR00447: aminoacyl-tRNA hydrolase" amino acids 1 to 170 (170 residues), 180.3 bits, see alignment E=1.6e-57 PF01195: Pept_tRNA_hydro" amino acids 3 to 183 (181 residues), 213.3 bits, see alignment E=1.3e-67

Best Hits

Swiss-Prot: 100% identical to PTH_RHOPT: Peptidyl-tRNA hydrolase (pth) from Rhodopseudomonas palustris (strain TIE-1)

KEGG orthology group: K01056, peptidyl-tRNA hydrolase, PTH1 family [EC: 3.1.1.29] (inferred from 100% identity to rpa:RPA4355)

Predicted SEED Role

"Peptidyl-tRNA hydrolase (EC 3.1.1.29)" (EC 3.1.1.29)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>TX73_022575 aminoacyl-tRNA hydrolase (Rhodopseudomonas palustris CGA009)
MRLFVGLGNPGAKYQGNRHNIGFMVIDEIARRHGFSPWRRRFQGETADGVLDGERITLLK
PLTYMNESGRAVQDAASFYKIGQNEIAVFHDEIELPPAKVRVKVGGGIAGHNGLRSISAH
IGNDYLRVRLGVGHPGAKELVHNHVLGDFAKSERPWVEALCEIAADNAGLIAKGKDASFA
NKVHLAMQAKGFYDNDKQAKGGERDK