Protein Info for TX73_020695 in Rhodopseudomonas palustris CGA009

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 PF12860: PAS_7" amino acids 42 to 154 (113 residues), 45.2 bits, see alignment E=1.4e-15 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 157 to 321 (165 residues), 184.2 bits, see alignment E=7.6e-59 PF00990: GGDEF" amino acids 161 to 318 (158 residues), 164.3 bits, see alignment E=3e-52 PF17853: GGDEF_2" amino acids 215 to 308 (94 residues), 25.9 bits, see alignment E=1.5e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA3994)

Predicted SEED Role

"diguanylate cyclase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>TX73_020695 diguanylate cyclase (Rhodopseudomonas palustris CGA009)
MHKRLTEETHHSAGSPEQPEIAGLHRELAEARQALETLYAALDNVDAGLLILNEELRAVY
SNPVLHVMFRANSAEEIRQNRPLYAEMLAASAQAVAVNLEDYVSRRLAWVQSGDPKPMDL
AMTDGTALRCHLAVLPGGGRMLIYSDVTDIVRNAEELERLATTDGMTGVYNRRHFLTLAD
REWSRARRYERPMSFLMIDIDYFKAINDGFGHQVGDEMIVHLARLARDCKRDCDVLARLG
GEEFALLLPETDLAQAEVVAERLRREVAGNALVVASHAIPATVSIGVATALPGMKDVSDL
MKAADQALYDAKHAGRNRVICRACHDPAPTLVPALTPRCEAATMR