Protein Info for TX73_019845 in Rhodopseudomonas palustris CGA009

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 PF00989: PAS" amino acids 38 to 128 (91 residues), 31.5 bits, see alignment E=3.8e-11 TIGR00229: PAS domain S-box protein" amino acids 38 to 150 (113 residues), 61.6 bits, see alignment E=7.9e-21 PF08448: PAS_4" amino acids 39 to 145 (107 residues), 37.6 bits, see alignment E=5.6e-13 PF13426: PAS_9" amino acids 45 to 142 (98 residues), 35.2 bits, see alignment E=3.2e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 161 to 324 (164 residues), 156.5 bits, see alignment E=5.2e-50 PF00990: GGDEF" amino acids 163 to 322 (160 residues), 156 bits, see alignment E=1.9e-49

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpt:Rpal_4360)

Predicted SEED Role

"FIG01008478: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>TX73_019845 diguanylate cyclase (Rhodopseudomonas palustris CGA009)
MPDRGHDGPGQPHPSEPLCQATLCECLNENALLAKYAIDRIADMIIWLDEHGRVMFVNAA
ATKLLGYSQAEFLSMTVLDLDPLFDADIWRDHWREVESRGSFTLETVNRTKDGVDVAVEV
TVNFVECLGRKMNCSIVRDITERKRAAEQLAEMHRKLVQANLTDELTAIANRRRFDGVLS
TSYATHMRSGAPLSLILLDIDHFKAFNDRYGHLEGDRCLQRIAEVIDRRMFRAADLAARW
GGEEFVCILPDTDEAGALAVATALREAILDLAIPHEASPIARVVTASLGVVTATCVPDKT
AHSLFETADALLYEAKNLGRNRIVRSPSRG