Protein Info for TX73_017630 in Rhodopseudomonas palustris CGA009

Annotation: EAL domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 824 TIGR00229: PAS domain S-box protein" amino acids 269 to 390 (122 residues), 57.5 bits, see alignment E=1.5e-19 PF08448: PAS_4" amino acids 282 to 385 (104 residues), 28.6 bits, see alignment E=3.5e-10 PF13426: PAS_9" amino acids 283 to 383 (101 residues), 32.7 bits, see alignment E=1.9e-11 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 392 to 550 (159 residues), 131.8 bits, see alignment E=2e-42 PF00990: GGDEF" amino acids 395 to 550 (156 residues), 160 bits, see alignment E=1.1e-50 PF00563: EAL" amino acids 573 to 802 (230 residues), 254 bits, see alignment E=3.2e-79

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA3410)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (824 amino acids)

>TX73_017630 EAL domain-containing protein (Rhodopseudomonas palustris CGA009)
MSAAVTQVSENSTNQLAADLTVLQRKWYAAIQPGQSLPSYEEVMLGSLGRLADHLVLLEI
DGETPEVSRTGRYAQQWLCDERWDIPLDALSPDCGTALAQAASGALQNKRPHLGTAHCVR
DGIVQRYTLLALPTASRWGGTLVGVYVNEEAQRYNLLDAIFSSTDDGIVALTAIRGPDRR
PFDFQIVHVNHGASQLLRHPVSELRWSRLSAGHHLLCSADVAGRLIELVDSDASVTFAVD
SGDRNLSVSATAFGDVVSVTISDVTSLKKREESFRLLFDGNPMPMWVFDAQSFEFLSVND
AAVAHYGYPRERFLRMSLREIWPREEWIAHGQTLLEMRDSYQSEGNWRHIKADGSEIHVL
TFGRRVLFDGRDGFLVAVVDITERRKAEAKIAHMAHHDGLTNLPNRALYQQRLEQALAQA
RGSGTMVAVMCVDLDLFKNVNDSFGHPMGDRLLQCVAERLRQQIGDGDLVARLGGDEFAI
VLTSLATPNEASSFAARLIEILSAPYDMDGLEVVIGASIGIALAPSDGDECEALSRNADM
ALYRAKAAGGGCHHFFEKEMDRQAQIRRDMELDLRQAFARGEFELHYQPLIDLAEDRIGG
FETLLRWRHPERGMISPSDFIPVAEDIGLIVGLGEWVLRQACLEAASWPSDVKVAVNLSP
VQFRSRNLVQVVISALAQSSLVPHRLELEITESLFLADSEANLATLHQLRSLGVRISMDD
FGTGYSSLSYLRSFPFDKIKIDRSFVKDLTQRPDCLAIVRAIAGLGRSLDITTLAEGVES
VEQLDVLRAEGCHEVQGFLFSAARPASEICGLLMRFGRQASQAA