Protein Info for TX73_017035 in Rhodopseudomonas palustris CGA009

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 41 to 83 (43 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 177 to 199 (23 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details amino acids 265 to 287 (23 residues), see Phobius details amino acids 328 to 349 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 37 to 308 (272 residues), 130.4 bits, see alignment E=3.7e-42

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpt:Rpal_3716)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>TX73_017035 branched-chain amino acid ABC transporter permease (Rhodopseudomonas palustris CGA009)
MKHTSKLADIALLIGFAIVVALGPIIFTPIGAGYPDLLQKFAIYGIFAIGFNILFGLTGY
LSFGHAAFLGVGSYAAVWSFKLLSMDLLPAVAMSVVLAGLLALAIGFVSLRRSGIYFSIL
TLAFAQMCYNMAYSVLTPITNGETGLRVLRQDPRYLDAAIGYVSPTPSLFGMQITGWTGF
YICGAVLVAAFGLSIAIFRSPFGMTLRAIKSNQNRMGYTGYSTRPYLLSAFVISGMFAGL
AGALLAATDPLAGAERMQWTASGEVVLMTILGGAGTLLGPVLGTGIIKYFENIFSAYNEA
QLKAMFTFVPDGLREPVVKTLGLFVGEGWQLTLGLLFMAVVIFLPGGVMEGINRLIGLKH
TPKVKSLGDSPQRDGLGEMVIEEMPAHDRTAEIEKKAAEKKARATAP