Protein Info for TX73_015915 in Rhodopseudomonas palustris CGA009

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details transmembrane" amino acids 24 to 43 (20 residues), see Phobius details amino acids 55 to 78 (24 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 111 to 136 (26 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 171 to 333 (163 residues), 150.4 bits, see alignment E=2e-48 PF00990: GGDEF" amino acids 172 to 329 (158 residues), 156.6 bits, see alignment E=2.5e-50

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA3076)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>TX73_015915 GGDEF domain-containing protein (Rhodopseudomonas palustris CGA009)
MAIFSTTLMAAVVAATTDAIWAIVWLAVELGFGAARYAALAALQRDEAAGRPGNAVLPLY
LGMSWAICYGIGCGLCAISGEWLLILMAGIFISGLAGGISSRNSGTPRYGITLIYLLGTP
YSVAMVLSPLPYMYIVGLLVPIWGFGMALVLLENYEVLLNLFLSERKNRRLANYDSLTGL
PNRVMKRQRFERLLRGADASAPAPLTVFCLDLDGFKSANDRFGHAAGDAVLVSVAERLRS
SVREQDQVFRVGGDEFVVLLPGTRTDDAAPVAQRIIAAIAEPFELAGHGRLDIGVSIGAA
TFPTDGSTVDDLLRAADIAMYEAKRQGKGRFVAAGRNGMAPQQPAPATANVTPASRVRPP
EPAGLWSKLQLPSLAKAAEIRITAHPQIPAGS