Protein Info for TX73_014875 in Rhodopseudomonas palustris CGA009

Annotation: LysE family translocator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 37 to 61 (25 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 106 to 130 (25 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 183 to 201 (19 residues), see Phobius details PF01810: LysE" amino acids 11 to 201 (191 residues), 109.9 bits, see alignment E=5.6e-36

Best Hits

KEGG orthology group: None (inferred from 98% identity to rpx:Rpdx1_2632)

Predicted SEED Role

"RhtB family transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>TX73_014875 LysE family translocator (Rhodopseudomonas palustris CGA009)
MVTAEFLITSLIVVASPGTGVLYTVATGLSRGPRASAIAAFGSTIGIVPHMAAAILGLAA
LLHTSAVAFQLFKYLGVAYLLYMAWKTLGERGPLSVDSDVGAPSALQMTVTGVLINILNP
KLSIFFLAFLPQFVSADDAHPLGRMIELSGIFMLMTFVVFVIYGLFAAWLRDHVITRPQV
MTWLRRSFAAAFVALGAKLATAER