Protein Info for TX73_014785 in Rhodopseudomonas palustris CGA009

Annotation: deoxyguanosinetriphosphate triphosphohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 TIGR01353: putative dGTPase" amino acids 31 to 397 (367 residues), 324.6 bits, see alignment E=1.3e-100 PF01966: HD" amino acids 69 to 179 (111 residues), 55.5 bits, see alignment E=7e-19 PF13286: HD_assoc" amino acids 303 to 395 (93 residues), 75.1 bits, see alignment E=5.2e-25

Best Hits

Swiss-Prot: 87% identical to DGTL1_RHOPS: Deoxyguanosinetriphosphate triphosphohydrolase-like protein (RPD_2796) from Rhodopseudomonas palustris (strain BisB5)

KEGG orthology group: K01129, dGTPase [EC: 3.1.5.1] (inferred from 100% identity to rpa:RPA2855)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>TX73_014785 deoxyguanosinetriphosphate triphosphohydrolase (Rhodopseudomonas palustris CGA009)
MSVGMAAPRAAFGCDPDHSRGRQFHEPPSRTRSAFRRDCDRVIHSNAFRRLKHKTQVFVF
HEGDHYRTRLTHSLEVAQIARALARQLGLDEDLTETLALAHDLGHPPFGHAGERALDACL
KDAGGFDHNAQTLRVLTALEHRYPEFDGLNLTWETLEGVVKHNGPLTDRTGAPLPRYAEH
GVPRGITEFNQRFDLQLWSFASLEAQVAAIADDIAYDAHDIDDGLRAGLFRIDDLIEVPL
VARIIAAIDRRYPGLDDGRRGAELVRELISHFIGAVAAEAERRIAETKPASANDVRRAEQ
ALVAFPAETAKAEAEIKAFLWTRMYRAERVMKVMRDAEAIVADLFQRYCDHPSDLPPDWL
PANGPVAECEADRLLRIRNFIAGMTDRYALAEHQRLFDSTPDLR