Protein Info for TX73_014495 in Rhodopseudomonas palustris CGA009

Annotation: pyridoxal kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00687: pyridoxal kinase
  • amino acids 3 to 267 (265 residues), 210.8 bits, E=1.3e-66
• PF08543: Phos_pyr_kin
  • amino acids 27 to 261 (235 residues), 81.5 bits, E=6.8e-27
• PF00294: PfkB
  • amino acids 117 to 246 (130 residues), 42 bits, E=7.6e-15

Best Hits

Swiss-Prot: 38% identical to PDXY_LEIXX: Pyridoxal kinase PdxY (pdxY) from Leifsonia xyli subsp. xyli (strain CTCB07)

KEGG orthology group: K00868, pyridoxine kinase [EC: 2.7.1.35] (inferred from 100% identity to rpa:RPA2799)

Predicted SEED Role

"Pyridoxal kinase (EC 2.7.1.35)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 2.7.1.35)

MetaCyc Pathways

• pyridoxal 5'-phosphate salvage II (plants) (8/9 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (10/12 steps found)
• pyridoxal 5'-phosphate salvage I (5/6 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (4/8 steps found)

KEGG Metabolic Maps

• Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.35

Protein Sequence (281 amino acids)

>TX73_014495 pyridoxal kinase (Rhodopseudomonas palustris CGA009)
MTTSIISIQSQVVHGHVGNSAAVLPMQAHGLNVAAVPTTLLSNHPGLGSTRGRVLDAELV
GELLRGIEERGLIETSRYIVSGYLGSRANGEVVAAFVKRARQLNPAITYICDPVMGDSHV
GVFVPDPVAACICNELVPLADLLTPNHFEAGLIAGHPLATWPELEAAVDKMQAWRGARVV
VTSCRQADTPDDSLENIVFEGGTSTRLPSPRLELAAAGTGDLYTGLLTAGLARNLPLVDA
ARRAAAIVLDVLKRTMAAGEREMQLASVIDALNPALGQPTR