Protein Info for TX73_014255 in Rhodopseudomonas palustris CGA009

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 PF13439: Glyco_transf_4" amino acids 20 to 187 (168 residues), 72.6 bits, see alignment E=1.4e-23 PF13579: Glyco_trans_4_4" amino acids 21 to 179 (159 residues), 74.3 bits, see alignment E=5.1e-24 PF13477: Glyco_trans_4_2" amino acids 26 to 162 (137 residues), 24.8 bits, see alignment E=7.8e-09 PF00534: Glycos_transf_1" amino acids 200 to 349 (150 residues), 96.4 bits, see alignment E=5.1e-31 PF20706: GT4-conflict" amino acids 203 to 361 (159 residues), 41.9 bits, see alignment E=2.3e-14 PF13692: Glyco_trans_1_4" amino acids 203 to 340 (138 residues), 102.8 bits, see alignment E=7.1e-33 PF13524: Glyco_trans_1_2" amino acids 268 to 363 (96 residues), 30 bits, see alignment E=1.7e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA2751)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (380 amino acids)

>TX73_014255 glycosyltransferase (Rhodopseudomonas palustris CGA009)
MTPATQDQPLRIVHAVRAPVGGIIRHILDLANGQADRGHHVALITDSLTGGDRAVAALDE
IAPKMKLGVYRLPIRREPSITDLFVWGRFVRLIATLRPDVLHGHGAKAGIFMRVVPRPTG
SIRVYTPHGGSLHYPTTTFKGQLYSRLERLSMNRTELFLFESEFARSTYERMIGKPEGLV
RCVFNGVTAGEFDPVSLAAEATDVCYVGEFRHIKGADLLVDAIARLRAEGRSVTLTLGGD
GEETAALKAQVARLDLGGAVRFIGHVKARHGFAQGRLLVVPSRGDSMPYVVIEAAAAGVP
MVAANVGGIPEIFGPDHRDALFAPSDPAAMAKAIAAALDDLNAARDRARQLRERIFLHFS
QKAMVEGVLAGYREALAQQR