Protein Info for TX73_011705 in Rhodopseudomonas palustris CGA009

Annotation: sodium/glutamate symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 38 to 55 (18 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 93 to 117 (25 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details amino acids 159 to 182 (24 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details amino acids 241 to 259 (19 residues), see Phobius details amino acids 278 to 300 (23 residues), see Phobius details amino acids 306 to 329 (24 residues), see Phobius details amino acids 338 to 361 (24 residues), see Phobius details amino acids 373 to 397 (25 residues), see Phobius details TIGR00210: sodium/glutamate symporter" amino acids 2 to 396 (395 residues), 386.4 bits, see alignment E=6.7e-120 PF03616: Glt_symporter" amino acids 2 to 369 (368 residues), 337.4 bits, see alignment E=4.5e-105

Best Hits

KEGG orthology group: K03312, glutamate:Na+ symporter, ESS family (inferred from 100% identity to rpa:RPA2262)

Predicted SEED Role

"Sodium/glutamate symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>TX73_011705 sodium/glutamate symporter (Rhodopseudomonas palustris CGA009)
MEIDAFYTFTIAVILLLTGKIATLNAPLLRKYSIPEPVVGGFLCTAVVALSYTLLDRQIT
FDLAMRDFLLLLFFAGIGLKAEVKMLLAGGRPLVILLSLAVVLMLIQNFAGMGMASLFGL
EAKAGLMVGSISLTGGIGTTLAWAPTFTERLGITNAMELGVAANTVGLIAACMIGGPVAA
FLMKRHNVAATDDPELAIGVSNDGRQPKLDYFCILWAVLALNLAIILGLGIHDALTRTGL
NLPAFVSCLMAGILIRNLMPIAVSSRVQRLWPGVDDGLTLVSDLALGLFLTMALMGLQLW
QLNGVFTFVASALVVQIILAVIFTISIVFRFMGKDYEAVVISAGFGGIALGSTATAIANM
TAVTQQYGAAHRAFIVVPLVCGFFIDIVNALIISAFVG