Protein Info for TX73_010435 in Rhodopseudomonas palustris CGA009

Annotation: MgtC/SapB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 36 to 53 (18 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details PF02308: MgtC" amino acids 11 to 138 (128 residues), 114.2 bits, see alignment E=2.4e-37

Best Hits

KEGG orthology group: K07507, putative Mg2+ transporter-C (MgtC) family protein (inferred from 100% identity to rpa:RPA2025)

Predicted SEED Role

"Mg(2+) transport ATPase protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (153 amino acids)

>TX73_010435 MgtC/SapB family protein (Rhodopseudomonas palustris CGA009)
MLPWWEILLRLGVAAIAGGLIGLNRDLKNKPIGMRTLPLVALTSALLVAHADHSATSDQL
SDPTSRVIQGILTGIGFLGAGVIVRSGNRLEIHGLTTAACTWLAAGIGIVCGAGQWLIVG
VALMITFAVLIGGHPAERLLHRLLRGRQGRTRP