Protein Info for TX73_009645 in Rhodopseudomonas palustris CGA009

Annotation: PepSY-associated TM helix domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 192 to 216 (25 residues), see Phobius details amino acids 338 to 359 (22 residues), see Phobius details PF03929: PepSY_TM" amino acids 12 to 361 (350 residues), 211.3 bits, see alignment E=1.4e-66

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA1875)

Predicted SEED Role

"putative iron-regulated membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (381 amino acids)

>TX73_009645 PepSY-associated TM helix domain-containing protein (Rhodopseudomonas palustris CGA009)
MTGTRALRIWSKVHTWTSLISMLFLLMLCLTGLPLIFHEEIEELTEQQFAAPHLPGNVPA
APVDDVLLAAQQARPGDHVLFVTWRDEQPDTVVVTMSPTPKPMRGKFYRLVMDGRTKAVL
GEERPQQGVMDIILLLHKNMMLELPGELFLGAMGLLLVVSIVSGVVVYAPFMRRLEFGTV
RQRSRRLKWLDLHNLFGIVTTVWLFVVGATGAINTLAMPMYDYWRGQVLPPLLAPYRGAP
VAQPSSLDQAIARVRAALPEGRLSSITMPTAENFGSPRHLVVWMKGNSALTALIATPTLV
DVDQTVPVLVPQMPWYLTLLQMSRPLHFGDYGGLPLKIVWGLLDLVCIVVLITGLYLWIA
KQRFGGSVRSRTAAPSDARPA