Protein Info for TX73_007715 in Rhodopseudomonas palustris CGA009

Annotation: Coenzyme F420 hydrogenase/dehydrogenase, beta subunit C-terminal domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 PF04422: FrhB_FdhB_N" amino acids 77 to 152 (76 residues), 81.9 bits, see alignment E=3e-27 PF04432: FrhB_FdhB_C" amino acids 161 to 302 (142 residues), 95.2 bits, see alignment E=3.5e-31

Best Hits

KEGG orthology group: K00441, coenzyme F420 hydrogenase beta subunit [EC: 1.12.98.1] (inferred from 100% identity to rpt:Rpal_1688)

Predicted SEED Role

"Coenzyme F420-reducing hydrogenase related protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.12.98.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>TX73_007715 Coenzyme F420 hydrogenase/dehydrogenase, beta subunit C-terminal domain (Rhodopseudomonas palustris CGA009)
MHDRNTPSALWTPPLNAPAERELCTDCGVSRMSDPKQCGQACQFIKPDYPAMERRVHGRN
RDAATGDEAFFGPYRRMVQAAMKQPREGAQWTGITTTIAQRLLETGAVDAVIAMAPDPSD
KWKPMPVLVTKPEGMAQCRGMRMGYAPSLALIEPAIAAGYKRLAVIGVPCQIYALRRLQD
QLGLEKLYVIGTPCSDNTTTEAFHGFLDLLSDKPETITYLEFRADYHVELRFDDGNVKAI
PFLLLPISKLPPDFFPITCRTCVDYTNTLADITVGYMGGRGEQWLLVRNERGEELLKLLG
DDVRLSEPTSAGNRVAPVKGFLKNTELAAGGLPVRGMPNWLRPFMGWLMPKVGPRGIEFA
RARVEMKAVETVLHLRRHYKHKMKNMIPAHVWALVKPYGLEPQDGERRD