Protein Info for TX73_005285 in Rhodopseudomonas palustris CGA009

Annotation: molybdenum cofactor biosynthesis protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 TIGR02667: molybdenum cofactor biosynthesis protein B" amino acids 9 to 171 (163 residues), 267 bits, see alignment E=5e-84 TIGR00177: molybdenum cofactor synthesis domain" amino acids 14 to 152 (139 residues), 123.6 bits, see alignment E=6.6e-40 PF00994: MoCF_biosynth" amino acids 16 to 157 (142 residues), 115.6 bits, see alignment E=7.6e-38

Best Hits

Swiss-Prot: 51% identical to MOAB_ECOLI: Molybdenum cofactor biosynthesis protein B (moaB) from Escherichia coli (strain K12)

KEGG orthology group: K03638, molybdenum cofactor biosynthesis protein B (inferred from 99% identity to rpt:Rpal_1220)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaB" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>TX73_005285 molybdenum cofactor biosynthesis protein B (Rhodopseudomonas palustris CGA009)
MASKDQPKQFIPLNIAVLTVSDTRSLDDDKSGATLVERLSGAGHRLAAREIVTDDVENIR
AVIRRWIADDGIDAIITTGGTGFTGRDVTPEAIEPLFEKRMDGFSIAFHMLSWGKIGTST
IQSRATAGVAGATYIFCLPGSPGACRDGWDGILAAQLDYRTRPCNFVEIMPRLDEHLRRS
KS