Protein Info for TX73_005195 in Rhodopseudomonas palustris CGA009

Annotation: alkyl sulfatase dimerization domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 648 PF00753: Lactamase_B" amino acids 110 to 335 (226 residues), 72.4 bits, see alignment E=1e-23 PF14863: Alkyl_sulf_dimr" amino acids 372 to 510 (139 residues), 204.6 bits, see alignment E=1.7e-64 PF14864: Alkyl_sulf_C" amino acids 522 to 642 (121 residues), 129.6 bits, see alignment E=1.6e-41 PF02036: SCP2" amino acids 552 to 631 (80 residues), 27 bits, see alignment E=9.2e-10

Best Hits

Swiss-Prot: 51% identical to BDS1_YEAST: Alkyl/aryl-sulfatase BDS1 (BDS1) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: None (inferred from 100% identity to rpa:RPA1010)

Predicted SEED Role

"alkyl sulfatase (EC 3.1.6.-)" (EC 3.1.6.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.6.-

Use Curated BLAST to search for 3.1.6.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (648 amino acids)

>TX73_005195 alkyl sulfatase dimerization domain-containing protein (Rhodopseudomonas palustris CGA009)
MSETTTIANDATAPKDASASVTARHEAVLDELPFSDTTDFDDAARGFLGSIDHAAISSAQ
GRTVWSLEPYRFLQKEIAPATVDPSLWRQSRLNMQHGLFEVVPGVYQVRGFDIANMTLIE
SDNGVIVVDTLTSIEGARAAMQLYARHRGDRPVVAVIFTHTHADHWGGARGVLDDATLAS
GRVPIIAPDLFMEHAVSENIIAGPAMLRRAQYQFGPLLAKGSRGHVDCGLGKTMAAGTAA
LLRPTDLIKATGDTRRIDGVDFEFQMAPNSEAPAEMHFYVPRYKLLNLAENCTHNFHNLL
PFRGADVRDALAWSGYLGEALRLWGGKAEVMCGQHHWPVWGTERIDLMIRQQRDLYKFAH
DQTLRLMNHGLTAAEIAETIRLPKSLDGAWHARGYYGHIRHNVKAIYQKYLGWYDANPAN
LDPLPPVDAGKKYVDYMGGAEALLAKARADFARGEFRFVAQALSHLVFADPDNQDGRLLL
ADTFEQLGYQSESATWRNAYLFGAQELRHGMPKMPTRPGMPRETLSALKTSQIWDVLGVR
LNGPKAEGKTIVLNWQFTDTGEHWVLTLENCALTYLAGTQSATADAGFVLARSLLDEVIA
KQTSFPEAVMAGKIKVSGNPMKLAELMALMDEFPRMFEIVEPKRAAVT