Protein Info for TX73_003095 in Rhodopseudomonas palustris CGA009

Annotation: glutaredoxin 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 91 TIGR02181: glutaredoxin 3" amino acids 5 to 84 (80 residues), 103 bits, see alignment E=3.9e-34 PF00462: Glutaredoxin" amino acids 5 to 65 (61 residues), 64.5 bits, see alignment E=4e-22

Best Hits

Swiss-Prot: 51% identical to GLRX2_SYNY3: Probable glutaredoxin ssr2061 (ssr2061) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K03676, glutaredoxin 3 (inferred from 100% identity to rpa:RPA0598)

MetaCyc: 49% identical to reduced glutaredoxin 3 (Escherichia coli K-12 substr. MG1655)
Protein-disulfide reductase (glutathione). [EC: 1.8.4.2]

Predicted SEED Role

"Glutaredoxin 3 (Grx2)" in subsystem Glutaredoxins or Glutathione: Redox cycle

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (91 amino acids)

>TX73_003095 glutaredoxin 3 (Rhodopseudomonas palustris CGA009)
MPAAIEIFTRPGCGYCSAAKSLLNRKKAAFTEYDVAVDPGFRVKMDERAGPGATYPQIFI
GDLHVGGCDDLYALDREGKLDALLADEKAAS