Protein Info for TX73_002275 in Rhodopseudomonas palustris CGA009

Annotation: transcription termination factor NusA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 537 PF08529: NusA_N" amino acids 9 to 129 (121 residues), 132.8 bits, see alignment E=1.4e-42 TIGR01953: transcription termination factor NusA" amino acids 9 to 348 (340 residues), 440.7 bits, see alignment E=3.2e-136 PF00575: S1" amino acids 136 to 198 (63 residues), 29.8 bits, see alignment E=1.3e-10 PF13184: KH_5" amino acids 234 to 302 (69 residues), 102.3 bits, see alignment E=2.6e-33 TIGR01954: transcription termination factor NusA, C-terminal duplication" amino acids 371 to 420 (50 residues), 66.1 bits, see alignment 2.2e-22 PF14520: HHH_5" amino acids 376 to 415 (40 residues), 23.9 bits, see alignment 9.2e-09

Best Hits

Swiss-Prot: 54% identical to NUSA_RICCN: Transcription termination/antitermination protein NusA (nusA) from Rickettsia conorii (strain ATCC VR-613 / Malish 7)

KEGG orthology group: K02600, N utilization substance protein A (inferred from 100% identity to rpt:Rpal_0442)

Predicted SEED Role

"Transcription termination protein NusA" in subsystem NusA-TFII Cluster or Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (537 amino acids)

>TX73_002275 transcription termination factor NusA (Rhodopseudomonas palustris CGA009)
MAVSANRLELLQIADAVAREKTIDRSIVIAAMEDAIAKAARARYGSETDVHAEIDPKKGE
LRLSRHMLVVEQVENPANQISLKDAQRANPGAQIGDTIADTLPPLEYGRIAAQSAKQVIV
QKVREAERDRQYMEFKDRIGDIVNGVVKRVEYGSVIVDLGRGEAIIRRDEMLPRESFRNG
DRVRAYVFDVRRETRGPQIFLSRTHPQFMAKLFAQEVPEIYDGIVEIKAVARDPGSRAKI
GVVSRDSSVDPVGACVGMRGSRVQAVVNELQGEKIDIIPWSPDIATFVVNALAPAEVSKV
VIDEDRERIEVVVPDTNNQLSLAIGRRGQNVRLASQLTGWDIDILTESEESERRQADFEK
TTRAFMDALNVDEVVGQLLASEGFTSVEELALVDPRELASIEGFDEETAAELQTRASEYL
DRIESELEARRLELGVEDALKDVPGVTSKMLVKFGENDVKTVEDLAGCATDDLVGWTERK
DGAEPVKYPGILDGMEMSREDAEHLIMQARVKAGWIDESELASEEDPADEASDESAD