Protein Info for TX73_002030 in Rhodopseudomonas palustris CGA009

Annotation: EAL domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 745 PF12860: PAS_7" amino acids 72 to 185 (114 residues), 76.8 bits, see alignment E=5.3e-25 TIGR00229: PAS domain S-box protein" amino acids 182 to 302 (121 residues), 52.3 bits, see alignment E=6.3e-18 PF13188: PAS_8" amino acids 188 to 243 (56 residues), 29.3 bits, see alignment 2.1e-10 PF13426: PAS_9" amino acids 197 to 294 (98 residues), 23.3 bits, see alignment E=2.2e-08 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 302 to 464 (163 residues), 136.3 bits, see alignment E=8.3e-44 PF00990: GGDEF" amino acids 306 to 461 (156 residues), 150.6 bits, see alignment E=1.2e-47 PF00563: EAL" amino acids 484 to 713 (230 residues), 246.2 bits, see alignment E=1.1e-76

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpt:Rpal_0395)

Predicted SEED Role

"putative diguanylate cyclase (GGDEF)/phosphodiesterase (EAL) with PAS domains"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (745 amino acids)

>TX73_002030 EAL domain-containing protein (Rhodopseudomonas palustris CGA009)
MPQVRLKKKKTARIRPPAGSAKPRRSALPAPKTLSKPRRTARPADVAEGERAVAAALEEA
RRSHARLREAIDILPQGIVFLDAEGRYILWNKRYAEIYKASADQFSPGARIQDTMRIGIA
RGDYPEAEGREEEWIAERLQRMFNPGSSHEQVLADGRCIQIEERTTSDGGIIGLRVDITE
LKQREASFRLMFESNPVPMIVCAVNDERILAVNDAAVEHYGYSPSEFASLTIRRLQAFET
ELPWAGNHTHEERTARTWKHVKADGSLIDLAIYSRQLTYNGEPAVLLALMDITERKRAEM
RLAFMAHHDGLTGLPNRNSLRKRLDELLIQTRRTGEKIAVLFVGIDNFKAVNDTLGHAVG
DKLLRGVARRLRSTLREEDPLARLNSDEFAVIQTGIKRPEDIVLLAKRLLHAIAEPYLLQ
GHSVVVGASIGIAVAPGDGDDSEKLLMNADMALSRAKKDTRGTFSFFEVGMDARAQARRK
IETDLRAALQHEVLRPYYQPLVRLADGRITGSEALVRWPHPERGMISPAEFIPVAEDTGL
INAIGAQILRSACMDAARWPDDVRVAVNLSPLQFRVGNLLSVVMDALKQSGLPPRRLELE
ITETLLLEKSSQVLATLHALRALGVRISMDDFGTGYSSLSYLRSFPFDKIKIDQSFVRGL
CDNRESQAIVRSIISLGNGLGVTITAEGVESEAELSWLRAEGCQEAQGFLFSQARPNAEI
TGLLDLQQSGASAGAEFAMGSARVA