Protein Info for TX73_001925 in Rhodopseudomonas palustris CGA009

Annotation: EAL domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 808 PF13426: PAS_9" amino acids 54 to 108 (55 residues), 15.1 bits, see alignment 6.8e-06 amino acids 170 to 236 (67 residues), 18.2 bits, see alignment E=7.5e-07 amino acids 300 to 363 (64 residues), 10.9 bits, see alignment E=0.00014 PF08447: PAS_3" amino acids 272 to 358 (87 residues), 29.8 bits, see alignment E=1.8e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 371 to 536 (166 residues), 117.9 bits, see alignment E=3.7e-38 PF00990: GGDEF" amino acids 375 to 532 (158 residues), 135 bits, see alignment E=6.4e-43 PF00563: EAL" amino acids 553 to 789 (237 residues), 235 bits, see alignment E=2.4e-73

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA0370)

Predicted SEED Role

"putative diguanylate cyclase (GGDEF)/phosphodiesterase (EAL) with PAS domains"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (808 amino acids)

>TX73_001925 EAL domain-containing protein (Rhodopseudomonas palustris CGA009)
MARAAYWESYSATATDFWMSAEFTSLYDADTPDDSVPLAPARDHDLTDSHAILQAHYAAC
WTEGRPFAVETKLIKPDGRLLDCVVHGEPEFDANGQVQRVFGIVRDATPETSALRQLAVS
EQRLADFVSTASDWCWESGPDHRLLPYPKSLDGNAALQTVASGGKARWELAYAPDEEGSM
ALHRDDMEAHRPFRDFIYTSIGNDGSRIIISTSGKPIFADDGTFLGYRGTASDITQLAAA
RTLLDQRTGALEEAHRLGRIGTWTHRLDTGRTVWSPELYQLLGLEPDAFEPTYEGTEPYF
LDDDAARLLKIQKRVLRTSTTEATDIRILHTDGTPRDLAIICKAEISNGNVIGLIGTAQD
VTDRKEAERRLEQLAYTDPLTGLANRALYKRKLADLFENPMAEHGQNALYLIDLDRFKEV
NDSLGHSTGDSLLIHVAGVLRQELGPQAFIARIGGDEFAVLTNSPNTSVEATTALADRLI
AKLSVPVELAEGEACIGATIGIAILPEHGATAEKASRNADLALYMAKEAGRGRAQLFEPM
YAEAVDQKLDLGRRLRHAVDSGGLNTHYQPQIDLKTGRVIGFEALLRWSHPERGPISPAE
FIPIAETTGLIVDLGHWVLRDACKQMRGWLDAGLPARTISVNVSPAQIWNGDFEKVVATV
LADTGLPPELLCLELTENLFVDHTKQKVSTTLAALSKLGIQLALDDFGSGYSSLGYLTRL
PFNRLKIDRSFVDGIATVPEKRKLLGGIIALSHGLGMSVVAEGAELQAEVDLLAAFDCDF
VQGYAFSKPVAADQAAVVAAEIERKPGR