Protein Info for TX73_000110 in Rhodopseudomonas palustris CGA009

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF00106: adh_short" amino acids 7 to 198 (192 residues), 105.7 bits, see alignment E=4.4e-34 PF13561: adh_short_C2" amino acids 17 to 195 (179 residues), 73.4 bits, see alignment E=4.5e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA0021)

Predicted SEED Role

"Short-chain dehydrogenase, associated with 2-hydroxychromene-2-carboxylate isomerase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>TX73_000110 SDR family oxidoreductase (Rhodopseudomonas palustris CGA009)
MTPRNATVAVIGAGDYIGAEIAKKFAAEGFTVFAGRRNGEKLAPLVAEIEAAGGRIVARS
LDARNEDEVTAFLNAADAHAPLEVTIFNVGANVNFPILETTDRVFRKVWEMACWAGFVSG
RESARLMLAHGQGKIFFTGATASLRGGSGFAAFASAKFGLRAVAQSMARELMPKNIHVAH
LIIDSGVDTAWVRERREQMFGKDALANPDLLMPPAAVAGAYWQLYQQPKSAWTFEMEIRP
YGEKW