Protein Info for TX73_000100 in Rhodopseudomonas palustris CGA009

Annotation: cytochrome-c oxidase, cbb3-type subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 548 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 162 to 185 (24 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 226 to 246 (21 residues), see Phobius details amino acids 275 to 297 (23 residues), see Phobius details amino acids 307 to 325 (19 residues), see Phobius details amino acids 345 to 365 (21 residues), see Phobius details amino acids 377 to 400 (24 residues), see Phobius details amino acids 421 to 442 (22 residues), see Phobius details amino acids 454 to 480 (27 residues), see Phobius details amino acids 505 to 527 (23 residues), see Phobius details TIGR00780: cytochrome c oxidase, cbb3-type, subunit I" amino acids 84 to 542 (459 residues), 721 bits, see alignment E=3.6e-221 PF00115: COX1" amino acids 88 to 512 (425 residues), 377.3 bits, see alignment E=5.2e-117

Best Hits

Swiss-Prot: 85% identical to FIXN_BRADU: Cytochrome c oxidase subunit 1 homolog, bacteroid (fixN) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K00404, cb-type cytochrome c oxidase subunit I [EC: 1.9.3.1] (inferred from 100% identity to rpa:RPA0019)

MetaCyc: 62% identical to cbb3-2 cytochrome c oxidase subunit N (Pseudomonas putida KT2440)

Predicted SEED Role

"Cytochrome c oxidase subunit CcoN (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (548 amino acids)

>TX73_000100 cytochrome-c oxidase, cbb3-type subunit I (Rhodopseudomonas palustris CGA009)
MNQALNSKRITLGEGGLTVVFALTTILSIYAAIYAKDAPFAFHAALAAAFSAWAVFAIIV
RHRSRSGLPPQEINGAPNYNLGPIKFLSFMAMFWGIAGFSAGLYIALELAYPGLNIAQWV
NFGRLRPLHTSAVIFAFGGNVLLATSFYVVQKTTRARLAGDLAPWFVAIGYNFFIVIAGT
GYLLGVTQSKEYAEPEWYADLWLTIVWVTYLLVFLATLMKRKEPHIYVANWFYLAFIITI
AVLHLGNNPTLPVSFLGSKSYIAWSGVQDAMFQWWYGHNAVGFFLTAGFLAIMYYFIPKR
AERPVYSYRLSIIHFWALIFLYIWAGPHHLHYTALPDWTQTLGMTFSIMLWMPSWGGMIN
GLMTLSGAWDKLRTDPVLRMMVVSVAFYGMSTFEGPMMAIKAVNSLSHYTDWTIGHVHSG
ALGWVGFVSFGALYCLVPWVWGRKQLYSIRLVNWHFWIATLGIVLYISAMWVSGILQGLM
WRAYTSLGFLEYSFIESVEAMHPFYAIRAAGGGLFLIGALIMAYNLWMTVRVGERSEAQP
RVALQPAE