Protein Info for Synpcc7942_B2623 in Synechococcus elongatus PCC 7942

Name: srpD
Annotation: cysteine synthase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 TIGR01139: cysteine synthase A" amino acids 9 to 307 (299 residues), 379.8 bits, see alignment E=8.9e-118 PF00291: PALP" amino acids 9 to 296 (288 residues), 232 bits, see alignment E=5e-73 TIGR01136: cysteine synthase" amino acids 9 to 307 (299 residues), 377.7 bits, see alignment E=4.3e-117

Best Hits

Swiss-Prot: 51% identical to CYSK_MYCTO: O-acetylserine sulfhydrylase (cysK1) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K01738, cysteine synthase A [EC: 2.5.1.47] (inferred from 100% identity to syf:Synpcc7942_B2623)

MetaCyc: 48% identical to O-acetylserine (thiol) lyase (Arabidopsis thaliana col)
Cysteine synthase. [EC: 2.5.1.47]

Predicted SEED Role

"Cysteine synthase A (EC 2.5.1.47)" in subsystem Cysteine Biosynthesis (EC 2.5.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.47

Use Curated BLAST to search for 2.5.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q9R6V6 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Synpcc7942_B2623 cysteine synthase A (Synechococcus elongatus PCC 7942)
MPKILNRLTEWIGNTPLVRLQETAQQYGAIAEVLLKLEYLNPLGSVKDRTALSLIQSARS
QGLITAGTTLIEPTTGNTGIGLAFAAAAEQLRLILVMPDRVSAERIRLAKLLGAKVVLTP
AAEAMLGCIAKAQALQQQIPDSVILQQFQNPANPSIHQATTGPEIWRDTDGEVDIVVAGV
GTGGTLMGISRYLKPLRPRLQSIAVQPARSPVLSGGAAGSHQLTGMGPNFVSPLVDRSLI
DEILSAYEEDAIAVIRTCAAREGIPLGVSSGAIVWAALQVAKRPENAGKRIVAVCPSGSE
RYLSSTLLADISLESDDVSDWVAIPQGQA