Protein Info for Synpcc7942_2604 in Synechococcus elongatus PCC 7942

Name: ctaE
Annotation: cytochrome c oxidase subunit III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 transmembrane" amino acids 22 to 44 (23 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 132 to 155 (24 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details PF00510: COX3" amino acids 23 to 194 (172 residues), 122.4 bits, see alignment E=1.6e-39

Best Hits

Swiss-Prot: 54% identical to COX3_THEVL: Cytochrome c oxidase subunit 3 (ctaE) from Thermosynechococcus vulcanus

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 100% identity to syf:Synpcc7942_2604)

MetaCyc: 51% identical to cytochrome c oxidase subunit III (Parasynechococcus marenigrum WH 8102)
RXN-21237 [EC: 7.1.1.9]; 7.1.1.9 [EC: 7.1.1.9]

Predicted SEED Role

"Cytochrome c oxidase polypeptide III (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1 or 7.1.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31JY5 at UniProt or InterPro

Protein Sequence (195 amino acids)

>Synpcc7942_2604 cytochrome c oxidase subunit III (Synechococcus elongatus PCC 7942)
MTSTLEALKTHHLEEAHPDHRIFGLILFLVAEGMIFLGLFAAYLTFRAVNSLPAEQMPEL
ELLIPAINTTILISSSFVIHGAEDAIKQNNVKAVQRYFGITALMGVVFLVGQIYEYSQLT
FGLRDNLFASTFYALTGFHGLHVLVGLLAILAVLWRSRQPDYYSDQHHFGIEAAEIYWHF
VDIVWIVLFVLLYLI