Protein Info for Synpcc7942_2600 in Synechococcus elongatus PCC 7942

Name: ctaB
Annotation: protoheme IX farnesyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01040: UbiA
  • amino acids 1 to 244 (244 residues), 236.2 bits, E=1.9e-74
• TIGR01473: protoheme IX farnesyltransferase
  • amino acids 4 to 257 (254 residues), 294.7 bits, E=4.7e-92

Best Hits

Swiss-Prot: 100% identical to COXX_SYNE7: Protoheme IX farnesyltransferase (ctaB) from Synechococcus elongatus (strain PCC 7942)

KEGG orthology group: K02301, protoheme IX farnesyltransferase [EC: 2.5.1.-] (inferred from 100% identity to syf:Synpcc7942_2600)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Biosynthesis of terpenoids and steroids
• Carotenoid biosynthesis - General
• Methionine metabolism
• Porphyrin and chlorophyll metabolism
• Riboflavin metabolism
• Terpenoid biosynthesis
• Tryptophan metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.-

Sequence Analysis Tools

See Q31JY9 at UniProt or InterPro

Protein Sequence (276 amino acids)

>Synpcc7942_2600 protoheme IX farnesyltransferase (Synechococcus elongatus PCC 7942)
MGLAAQGPLDPRLAIATLIGGGLAAAAANTLNCLYDRDIDAIMERTRWRPLPSGRIQPFE
AWAFALSLAALSFILLDWQANQLAAGLALAGIVFYVVIYTHGLKRHSSQNIVIGGAAGAI
PPLVGWAAVTGELAWPAWILFAIVCLWTPPHFWALALMIRDDYAAVKVPMLPVVVGNAAT
AQQILAYAGLLLPTTLALAWPLGAAGPFYSATALLLGLELLRRSRQLCQAPDSRPLARSL
FKFSIFYLMLLCGAIAMDCLPGAPSLSQAIAAWPGF