Protein Info for Synpcc7942_2576 in Synechococcus elongatus PCC 7942

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 32 to 52 (21 residues), see Phobius details amino acids 58 to 79 (22 residues), see Phobius details amino acids 222 to 240 (19 residues), see Phobius details amino acids 260 to 277 (18 residues), see Phobius details amino acids 320 to 344 (25 residues), see Phobius details amino acids 358 to 377 (20 residues), see Phobius details amino acids 385 to 407 (23 residues), see Phobius details amino acids 429 to 455 (27 residues), see Phobius details amino acids 476 to 496 (21 residues), see Phobius details PF02163: Peptidase_M50" amino acids 263 to 421 (159 residues), 55.4 bits, see alignment E=2.8e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to syc:syc1534_d)

Predicted SEED Role

"FIG01154369: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31K13 at UniProt or InterPro

Protein Sequence (504 amino acids)

>Synpcc7942_2576 hypothetical protein (Synechococcus elongatus PCC 7942)
MPLENATPILLLLGAIALIGWGFWRRRGLGKLGVLANIQSLALVSPWLLFFGLSLFGIYL
RLTVVLSLLVVMTVTYILLGRQIRQLSQDPEIQAQMRDRLAAMAARNTPTSPDRSPESEA
LTLEDDNQPHPLPADDLQQIKGIFGVDTFFATETIPYQEGAIFKGNLRGEAMVVQPRLAQ
LLKERLGDRYRLFLINDPSDRPAVVVLPSTACEPPKVLPAQYVLAVLLAGFTLWTCFLRG
AEQLYPNLDILLAPERLKDAAPLAIGLAALLGSRELAHRWMADRYQARLSPPYFLPSAEL
GGYGAYFRLQSILRNRTELFDIAAAGPLVGGGLSLLVFVVGLLLSGTADTTGLPLPSQLL
QSSVLIGLLARTVLGNAVQQTQLLVHPLAIVGWTGLIVNALNLIPIGQLSGGRLVQAVYG
RKVAGRLGTFALLILAIAAFTNVIAFYWGVLVLLFQRQPERPSAEELSEPDDTRSAVCLL
LLFLAIAVLLPLSPSVAGRLGIGL