Protein Info for Synpcc7942_2574 in Synechococcus elongatus PCC 7942

Name: mntA
Annotation: ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF00005: ABC_tran" amino acids 27 to 172 (146 residues), 107.1 bits, see alignment E=1.2e-34

Best Hits

Swiss-Prot: 45% identical to YCXD_CYAPA: Probable ABC transporter ATP-binding protein in ycf23-apcF intergenic region from Cyanophora paradoxa

KEGG orthology group: K09820, manganese/iron transport system ATP-binding protein (inferred from 100% identity to syc:syc1536_d)

Predicted SEED Role

"Probable ABC transporter ATP-binding protein in ycf23-apcF intergenic region"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31K15 at UniProt or InterPro

Protein Sequence (251 amino acids)

>Synpcc7942_2574 ATPase (Synechococcus elongatus PCC 7942)
MSQASAPNPPTLQAHHLSASYRDREVLQDVNLQLRAGQVVGIVGPNGAGKSTFLKALLGL
VPHQGEVFWRGLPLASRLPHVAYVPQRAQVDFDYPATVWDVVLMGRVAQTGWLRRFSAAS
QQAVKAALDRVELWDLRSRPIGELSGGQQQRVFIARSLAQEAELFLLDEPFAGIDRRSEG
LLYEILRDLAQQGHGVVVVHHDLGQAIQQFDELVLLNQRVIAQGHPRLVLQPDHLARAYG
ARLDITRYEAA