Protein Info for Synpcc7942_2513 in Synechococcus elongatus PCC 7942

Name: btpA
Annotation: Photosystem I assembly BtpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 PF03437: BtpA" amino acids 17 to 269 (253 residues), 355 bits, see alignment E=1.2e-110 TIGR00259: membrane complex biogenesis protein, BtpA family" amino acids 18 to 270 (253 residues), 369 bits, see alignment E=6.8e-115

Best Hits

Swiss-Prot: 80% identical to BTPA_SYNY3: Photosystem I biogenesis protein BtpA (btpA) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K06971, (no description) (inferred from 100% identity to syf:Synpcc7942_2513)

Predicted SEED Role

"photosystem I biogenesis protein BtpA" in subsystem Photosystem I

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31K76 at UniProt or InterPro

Protein Sequence (294 amino acids)

>Synpcc7942_2513 Photosystem I assembly BtpA (Synechococcus elongatus PCC 7942)
LQRLDSDVDLHRIFGTTTPVIGVVHLQPLPTAARWGGNLRAVIERAEQEATALAAGGVNG
IIVENFFDAPFPKNRVDPAVVSAMTLVVERLQNLVTIPLGLNVLRNDAHSALAIASCTGA
AFIRVNVLTGVMATDQGLIEGEAHQLLRYRRELGSSVQILADVLVKHARPLGTPNLTVAV
QDTIERGLADGVILSGWATGSPPSLEDLELAKAAAGDVPVFIGSGASIENIGQLLQAADG
VIVSSSLKRQGKREQSIDPVRVGRFVDTVRACQQRLQTVATPQAVNTNSASLSR