Protein Info for Synpcc7942_2503 in Synechococcus elongatus PCC 7942

Name: por
Annotation: protochlorophyllide oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 TIGR01289: light-dependent protochlorophyllide reductase" amino acids 5 to 321 (317 residues), 563.9 bits, see alignment E=5.8e-174 PF00106: adh_short" amino acids 8 to 132 (125 residues), 66.1 bits, see alignment E=3.1e-22 PF13561: adh_short_C2" amino acids 13 to 131 (119 residues), 41.4 bits, see alignment E=1.3e-14

Best Hits

Swiss-Prot: 80% identical to POR_LEPBY: Light-dependent protochlorophyllide reductase (por) from Leptolyngbya boryana

KEGG orthology group: K00218, protochlorophyllide reductase [EC: 1.3.1.33] (inferred from 99% identity to syc:syc1603_d)

Predicted SEED Role

"Light-dependent protochlorophyllide reductase (EC 1.3.1.33)" in subsystem Chlorophyll Biosynthesis (EC 1.3.1.33)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q935X4 at UniProt or InterPro

Protein Sequence (321 amino acids)

>Synpcc7942_2503 protochlorophyllide oxidoreductase (Synechococcus elongatus PCC 7942)
MSETQQPTVIITGASSGVGLYGAKALAARGWHVVMACRNLQKAAEAAKSLGINPENYSLM
EIDLGSLASVRRFVDQFRATGRSLDALVCNAAVYLPRLKEPQRSPEGYEISVATNHFGHF
LLCNLLLDDLKRSPAPEKRLVILGTVTANSKELGGKIPIPAPADLGNLEGLEAGFKAPIA
MIDGKKFKPGKAYKDSKLCNMITTRELHRRFHDSTGIVFSSLYPGCVADTPLFRNTPKLF
QKIFPWFQKNITGGYVTQELAGERVAQVVADPEFKTSGVHWSWGNRQQKDRQSFVQELSD
KASDDRTAQRLWDLSAKLVGL