Protein Info for Synpcc7942_2477 in Synechococcus elongatus PCC 7942

Name: sulA
Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF01370: Epimerase" amino acids 3 to 222 (220 residues), 75.4 bits, see alignment E=9.6e-25 TIGR01777: TIGR01777 family protein" amino acids 3 to 293 (291 residues), 359.1 bits, see alignment E=1.1e-111 PF01073: 3Beta_HSD" amino acids 4 to 121 (118 residues), 22 bits, see alignment E=1.5e-08 PF13460: NAD_binding_10" amino acids 7 to 168 (162 residues), 44.7 bits, see alignment E=3e-15 PF08338: DUF1731" amino acids 250 to 295 (46 residues), 75.9 bits, see alignment 3.2e-25

Best Hits

Swiss-Prot: 58% identical to Y1223_SYNY3: Epimerase family protein slr1223 (slr1223) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K07071, (no description) (inferred from 100% identity to syf:Synpcc7942_2477)

Predicted SEED Role

"Cell division inhibitor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8GIS3 at UniProt or InterPro

Protein Sequence (298 amino acids)

>Synpcc7942_2477 hypothetical protein (Synechococcus elongatus PCC 7942)
VKIAITGATGFVGQRLVERLQAEGHELRILSQRPTVAQQLTGCQVFDTATETSWLAALEG
ADAVVNLAGEPIAEQRWTPAQKQRLKNSRVQTTRALVTAITAATQKPQVLVTASAIGYYG
TSETAQFTEESAAGQDYLAEICQAWEQEAQAVTVSGTRLVTLRIGIVVGPGGAIGKMLGP
FKLFAGGPIGSGRQWVSWIQREDLVSLILEAIANPSYQGTYNATAPQAVRMADLSATLGE
VLQRPSWLPVPAFALEALLGEGALLVLEGQQVLPKRLEAAGFQFRYPDLKSALQQFLP