Protein Info for Synpcc7942_2464 in Synechococcus elongatus PCC 7942

Annotation: N-acetylmannosamine-6-phosphate 2-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 PF04131: NanE" amino acids 32 to 229 (198 residues), 159.1 bits, see alignment E=7.8e-51 PF01207: Dus" amino acids 134 to 215 (82 residues), 23.6 bits, see alignment E=2.6e-09

Best Hits

Swiss-Prot: 100% identical to NANE_SYNP6: Putative N-acetylmannosamine-6-phosphate 2-epimerase (nanE) from Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)

KEGG orthology group: K01788, N-acylglucosamine-6-phosphate 2-epimerase [EC: 5.1.3.9] (inferred from 100% identity to syf:Synpcc7942_2464)

Predicted SEED Role

"N-acetylmannosamine-6-phosphate 2-epimerase (EC 5.1.3.9)" in subsystem Sialic Acid Metabolism (EC 5.1.3.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31KC5 at UniProt or InterPro

Protein Sequence (232 amino acids)

>Synpcc7942_2464 N-acetylmannosamine-6-phosphate 2-epimerase (Synechococcus elongatus PCC 7942)
MDRQQQLRRLQGGLIVSCQAPADSPLHQPEIIAAIAVAAVQRGAVGIRLDTPEHVRAVRD
RLPETPIIGLWKRTFPDSSVYITPRYVEAEAIAAAGADIVALDCTLRPRPDGEDFCQIIP
RLQQELGCAVMADIDTLEAAIAAAKAGADLVGTTLYGYTEATQGQTPPGWDLLETAAQQL
PNTPVICEGGIASAQAARQACDRGAFAVVVGTAITGIDLQVQAYVTALNARP