Protein Info for Synpcc7942_2454 in Synechococcus elongatus PCC 7942

Name: apt
Annotation: adenine phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01090: adenine phosphoribosyltransferase
  • amino acids 3 to 158 (156 residues), 213.5 bits, E=1e-67
• PF00156: Pribosyltran
  • amino acids 46 to 148 (103 residues), 45.9 bits, E=3.8e-16
• PF00528: BPD_transp_1
  • amino acids 213 to 419 (207 residues), 137.2 bits, E=5.6e-44

Best Hits

KEGG orthology group: K00759, adenine phosphoribosyltransferase [EC: 2.4.2.7] (inferred from 100% identity to syf:Synpcc7942_2454)

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

MetaCyc Pathways

• superpathway of purine nucleotide salvage (10/14 steps found)
• adenine and adenosine salvage I (1/2 steps found)
• adenine and adenosine salvage II (1/2 steps found)
• adenine salvage (1/3 steps found)
• glyphosate degradation III (2/7 steps found)
• (aminomethyl)phosphonate degradation (2/8 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.7

Sequence Analysis Tools

See Q31KD5 at UniProt or InterPro

Protein Sequence (424 amino acids)

>Synpcc7942_2454 adenine phosphoribosyltransferase (Synechococcus elongatus PCC 7942)
MDLKTLIREIPDFPKPGILFRDYTTVLKDPQGWRYSIDRLTELIKPLEPTAIVGIESRGF
ILGAPLAYQLGLGFVPVRKPGKLPADTHSVEYELEYGSDRLEIHQDALAPGDRVVVVDDL
IATGGTASATATLIDRCSATLAGFAFVIELEGLNGRDRPWLEQYGRWLWQVVRYGNFGSS
FVYQRPVADLLWERVPNTLLLAICSLITTWAIALPLGIQAAVAQNQRSDRILQLISYLGQ
GTPSFITALLLLFLAQFLTPLLPIGGMTSLDFEDLTPLQQMADLGRHLILPVLALTLSGF
ASLQRISRGEMLEVLRQDYIRTARAKGLPEQRVIYVHALRNAINPLITLLGFEFATLLSG
AFIAEYFFNWPGLGRLILQAVFAQDLYLVMASLMMGAVMLILGNLLADLLLRWVDPRIRL
DDLN