Protein Info for Synpcc7942_2439 in Synechococcus elongatus PCC 7942

Name: crtR
Annotation: beta-carotene hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 120 to 137 (18 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details PF00487: FA_desaturase" amino acids 46 to 260 (215 residues), 119.9 bits, see alignment E=8.2e-39

Best Hits

KEGG orthology group: K02294, beta-carotene hydroxylase [EC: 1.14.13.-] (inferred from 100% identity to syc:syc1667_c)

MetaCyc: 67% identical to beta-carotene hydroxylase (Synechocystis sp. PCC 6803)
RXN-8025 [EC: 1.14.15.24]; 1.14.15.24 [EC: 1.14.15.24]; 1.14.13.- [EC: 1.14.15.24]

Predicted SEED Role

"Beta-carotene hydroxylase" in subsystem Carotenoids

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.- or 1.14.15.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31KF0 at UniProt or InterPro

Protein Sequence (331 amino acids)

>Synpcc7942_2439 beta-carotene hydroxylase (Synechococcus elongatus PCC 7942)
MSEAQTPLTVPKKFLGAPGGFNPTVALFLAGYTCAALSVLGYWCWSWPHWLSFLLSVTAL
HLVGTVIHDASHNVAHASRILNAILGHGSALLLGFTFPVFTRVHLQHHAHVNDPKNDPDH
IVSTFGPLWLIAPRFFYHEIYFFQRRLWKKFELLEWFLSRAVVIGIFACGVKFGFLGFLM
NYWLAPALVVGIALGLFFDYLPHRPFQERNRWRNARVYPGQVMNILIMGQNYHLIHHLWP
SIPWYLYRPAYHATKPLLDLRQSPQTLGILSSKKDFWNFIYDVFIGIRIHQSHEAEPQSS
VVPETKSSESAVLAKAPMSATEDSREPALTK