Protein Info for Synpcc7942_2434 in Synechococcus elongatus PCC 7942

Name: ilvH
Annotation: acetolactate synthase 3 regulatory subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 TIGR00119: acetolactate synthase, small subunit" amino acids 1 to 157 (157 residues), 218.2 bits, see alignment E=2.9e-69 PF01842: ACT" amino acids 4 to 68 (65 residues), 48.6 bits, see alignment E=1.1e-16 PF22629: ACT_AHAS_ss" amino acids 5 to 72 (68 residues), 93.8 bits, see alignment E=1.2e-30 PF13710: ACT_5" amino acids 12 to 73 (62 residues), 54.2 bits, see alignment E=2e-18 PF10369: ALS_ss_C" amino acids 84 to 157 (74 residues), 105.1 bits, see alignment E=3.1e-34

Best Hits

Swiss-Prot: 74% identical to ILVH_SYNY3: Acetolactate synthase small subunit (ilvH) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K01653, acetolactate synthase I/III small subunit [EC: 2.2.1.6] (inferred from 100% identity to syf:Synpcc7942_2434)

MetaCyc: 49% identical to acetohydroxy-acid synthase small subunit (Methanococcus aeolicus)
Acetolactate synthase. [EC: 2.2.1.6]; 2.2.1.6 [EC: 2.2.1.6]

Predicted SEED Role

"Acetolactate synthase small subunit (EC 2.2.1.6)" in subsystem Acetoin, butanediol metabolism or Branched-Chain Amino Acid Biosynthesis (EC 2.2.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31KF5 at UniProt or InterPro

Protein Sequence (172 amino acids)

>Synpcc7942_2434 acetolactate synthase 3 regulatory subunit (Synechococcus elongatus PCC 7942)
MKRTLSVLVEDEAGVLTRIAGLFARRSFNIESLAVGPAEQVGISRITMVVQGDDREIEQI
TKQLYKLINVLKVQDISEVPCVERELMLIKVNANSSNRSEILELVQIFRARVVDVAEDSL
IVEVVGDPGKMVAIVQVLQRFGIREISRTGKVALTRESGVNTEFLKALEARV