Protein Info for Synpcc7942_2433 in Synechococcus elongatus PCC 7942

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 97 to 117 (21 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details PF00561: Abhydrolase_1" amino acids 36 to 283 (248 residues), 87.9 bits, see alignment E=1.3e-28 PF12146: Hydrolase_4" amino acids 37 to 257 (221 residues), 40.7 bits, see alignment E=2.7e-14 PF12697: Abhydrolase_6" amino acids 37 to 287 (251 residues), 82.3 bits, see alignment E=1.2e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to syc:syc1673_c)

Predicted SEED Role

"Possible alpha/beta hydrolase superfamily, slr1827 homolog" in subsystem Synechocystis experimental

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31KF6 at UniProt or InterPro

Protein Sequence (306 amino acids)

>Synpcc7942_2433 hypothetical protein (Synechococcus elongatus PCC 7942)
MSLRSLTVATSQDWIWRGLRVRYAFRRSPQPTGAVPVIFLHGFGAGWRHWRDNIPALAEE
RDVYAIDLVGFGDSEKGYLHYGPAFWSELVRDFCQQFVGSAAVLIGNSLGSVVAMVTAHR
FPEQVHGLILLNLPDTSLLRSPAAHDRFKSLRQALLWALTPPWLIEPLLLWLRSPKRLKP
WLALAYSDRDRIDADLLDLIARPARSEEAGPALRAMTRFNAEVPRDWRADRVLPQLSQPI
LLIWGESDRLVPFSLAKRCQQLNPQLDWLPMPATGHCPHDDRPAFVNQSLNNWLSQHDPA
DVKIKA