Protein Info for Synpcc7942_2352 in Synechococcus elongatus PCC 7942

Name: lrtA
Annotation: sigma 54 modulation protein / SSU ribosomal protein S30P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 TIGR00741: ribosomal subunit interface protein" amino acids 1 to 102 (102 residues), 97.5 bits, see alignment E=2.8e-32 PF02482: Ribosomal_S30AE" amino acids 4 to 99 (96 residues), 93.4 bits, see alignment E=1.2e-30 PF16321: Ribosom_S30AE_C" amino acids 132 to 186 (55 residues), 89.2 bits, see alignment E=1.1e-29

Best Hits

Swiss-Prot: 62% identical to HPF_SYNP2: Ribosome hibernation promotion factor (hpf) from Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)

KEGG orthology group: K05808, putative sigma-54 modulation protein (inferred from 100% identity to syc:syc1751_d)

Predicted SEED Role

"Ribosomal subunit interface protein" in subsystem Ribosome activity modulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31KN7 at UniProt or InterPro

Protein Sequence (207 amino acids)

>Synpcc7942_2352 sigma 54 modulation protein / SSU ribosomal protein S30P (Synechococcus elongatus PCC 7942)
MKLVVQGTNIDVTAAIHDYVQQKLDKAVSHYQSFLTEIDVHLSVAKHAKSNPRQTAEVTI
YANGTVIRAEECNENLYASIDLVSDKITRQLKKYKEKLRDRKGQLSTAETADQLSDGALV
TDLLNGRQPELPQDIVRTKYFAMPAMTVEDALAQLQLVDHDFYMFRNAATGEINVIYERN
HGGYGVIQPRPEGNSEKAVVVRSEAVL