Protein Info for Synpcc7942_2268 in Synechococcus elongatus PCC 7942

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details amino acids 248 to 270 (23 residues), see Phobius details TIGR00303: TIGR00303 family protein" amino acids 20 to 362 (343 residues), 331.8 bits, see alignment E=2.5e-103

Best Hits

KEGG orthology group: None (inferred from 100% identity to syf:Synpcc7942_2268)

Predicted SEED Role

"Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (EC 2.4.2.21)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 2.4.2.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q31KX1 at UniProt or InterPro

Protein Sequence (381 amino acids)

>Synpcc7942_2268 hypothetical protein (Synechococcus elongatus PCC 7942)
MRTDAIACWGGEAQLFPWLTQVQGRSPLLAVLLAFTETALIPGISAAGKTPRDRRYTAHA
DAEFLYNGPNPQPQYPLPPLQAGASPVLITRACVEQLATPLFLIDAGLTQPLPVPAIRLN
SQPARCLSTGQAMPIAIAQQLFQQGQAHGAAIAAQHPDRWLVLGECVVGGTSTALALLLA
LGIEAAGCVSSSHPTCNHGQKLALVQQGLAAIPDRPARSPLELAAAIADPMLIAAAGMAM
AVSQTQSVLLAGGTQMLAAYALMAAIAQTGVAWQPDRIAVGTTRWVMVDPSAQVAQLGPA
IASRFGWEPLLLSTQLNFQRSRHAQLQVYEQGFVKEGVAAGGMAIAASLATGASVETLRQ
WVDDLGDRAIAASGIASAVTD