Protein Info for Synpcc7942_2132 in Synechococcus elongatus PCC 7942

Name: manB
Annotation: phosphoglucosamine mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02878: PGM_PMM_I
  • amino acids 26 to 155 (130 residues), 146.9 bits, E=6.3e-47
• TIGR01455: phosphoglucosamine mutase
  • amino acids 27 to 467 (441 residues), 579.6 bits, E=2e-178
• PF02879: PGM_PMM_II
  • amino acids 179 to 275 (97 residues), 62.8 bits, E=8.1e-21
• PF02880: PGM_PMM_III
  • amino acids 279 to 392 (114 residues), 116 bits, E=2e-37
• PF00408: PGM_PMM_IV
  • amino acids 398 to 459 (62 residues), 57.1 bits, E=3.1e-19

Best Hits

Swiss-Prot: 100% identical to GLMM_SYNP6: Phosphoglucosamine mutase (glmM) from Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)

KEGG orthology group: K03431, phosphoglucosamine mutase [EC: 5.4.2.10] (inferred from 100% identity to syc:syc1960_c)

Predicted SEED Role

"Phosphoglucosamine mutase (EC 5.4.2.10)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 5.4.2.10)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
• colanic acid building blocks biosynthesis (10/11 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis I (5/5 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (4/4 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• glycogen degradation I (6/8 steps found)
• sucrose biosynthesis II (6/8 steps found)
• starch degradation V (3/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (3/4 steps found)
• peptidoglycan recycling I (10/14 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• glycogen degradation II (4/6 steps found)
• UDP-α-D-glucose biosynthesis (1/2 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (3/5 steps found)
• glucose and glucose-1-phosphate degradation (3/5 steps found)
• glucosylglycerol biosynthesis (3/5 steps found)
• sucrose degradation II (sucrose synthase) (3/5 steps found)
• starch degradation III (2/4 steps found)
• starch biosynthesis (6/10 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (3/6 steps found)
• chitin biosynthesis (5/9 steps found)
• D-galactose degradation I (Leloir pathway) (2/5 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (2/8 steps found)
• CMP-legionaminate biosynthesis I (2/10 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (6/19 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
• streptomycin biosynthesis (2/18 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (6/24 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.10

Sequence Analysis Tools

See Q31LA7 at UniProt or InterPro

Protein Sequence (472 amino acids)

>Synpcc7942_2132 phosphoglucosamine mutase (Synechococcus elongatus PCC 7942)
MVSATRWETAIEVTPWIAAIAEQVPLFGTDGIRGRVGEHLTAPLAQQVGFWTGQVLRQAG
GDRGPVVVGQDSRNSSNMLAMALSSGLAAAGVEVLHLGLCPTPGVAYLTHHSEAIGGVMI
SASHNPPGDNGIKVFGADGSKLDRQLQAAIEAGLRGQQTSLPATTWGQHYYQPQLADHYQ
AAIAQSLGQRANLQGLKIVLDLAWGAAALLAPRLFRELGAEVIALHDLPDGNQINVNCGS
THLARLQAAVLEQGADMGFAFDGDADRVLAVDGRGRSVDGDHILFLWGRELEQQQQLPGQ
AIVTTVMANLGFERAWQAVGGEFVRTAVGDQYVQAEMQARGAMLGGEQSGHILCRHYALT
GDGTLTAAHVAALVQASGVSLADLVDQSFRPYPQLLRNVRVEDRDRRCNWQNCAALTQAI
AAAETDMGDRGRVLVRASGTEPLLRIMVEAEEAQQVEHWTTHLVQVAESHLL