Protein Info for Synpcc7942_2106 in Synechococcus elongatus PCC 7942

Name: cynB
Annotation: nitrate transport permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 80 to 106 (27 residues), see Phobius details amino acids 112 to 129 (18 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 177 to 193 (17 residues), see Phobius details amino acids 200 to 221 (22 residues), see Phobius details amino acids 227 to 246 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 89 to 246 (158 residues), 80.4 bits, see alignment E=7.1e-27

Best Hits

Swiss-Prot: 42% identical to NRTB_SYNY3: Nitrate import permease protein NrtB (nrtB) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to syc:syc1987_d)

Predicted SEED Role

"Cyanate ABC transporter, permease protein" in subsystem Cyanate hydrolysis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7BW13 at UniProt or InterPro

Protein Sequence (263 amino acids)

>Synpcc7942_2106 nitrate transport permease (Synechococcus elongatus PCC 7942)
MVRTPVPLYLRWAVSILSVLAFLAIWQIAAASGFLGKTFPGSLRTLQDLFGWLSDPFFDN
GPNDLGIGWNLLISLRRVAIGYLLATVVAIPLGIAIGMSALASSIFSPFVQLLKPVSPLA
WLPIGLFLFRDSELTGVFVILISSLWPTLINTAFGVANVNPDFLKVSQSLGASRWRTILK
VILPAALPSIIAGMRISMGIAWLVIVAAEMLLGTGIGYFIWNEWNNLSLPNIFSAIIIIG
IVGILLDQGFRFLENQFSYAGNR